Basic Information | |
---|---|
Taxon OID | 3300005760 Open in IMG/M |
Scaffold ID | Ga0078205_141076 Open in IMG/M |
Source Dataset Name | Algae and Fungi communities from freshwater lake in Auvergne, France - sample AST3 at day 1 of algae bloom |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Institut Pasteur, Lille, France |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1252 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Auvergne, France | |||||||
Coordinates | Lat. (o) | 45.495847 | Long. (o) | 2.887922 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092089 | Metagenome / Metatranscriptome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078205_1410762 | F092089 | AGG | VQLQWRPCLAHKISHISFRIFNRTQSPESFKEMKLLSTIGILLALSISFAFAGKSTFKKFPGGLSKKNYVPRNIGKRILKGDSRKGSIVKKSKKKGARASTNTEPTIIQSYVNWAVCLHDRTSNKACSPQLGVPKGYYFLDPFVVYSSCSNITIPVRKCNVPVDPKGEPLTVVIPVVGDVWIDYDDNPKGGICNESRPTGNDPLLLYLKTNVVTEHLKYTQLPYAFVNGRSLSMEYIIEDEPFYLKSCSNKVQCCDEGCDFPSCEDCGGVDAYPIIGYIATDTSRWKPGEKRYYQWGYGIDDDACGCSGCSMGRVELTAVEKK* |
⦗Top⦘ |