Scaffold Ga0076925_1011829

Overview

Basic Information

• Taxon OID: 3300005748
• Scaffold ID: Ga0076925_1011829
• Source Dataset Name: Seawater microbial communities from Vineyard Sound, MA, USA - control T7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6362
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.4417
  • Long. (^o): -70.7744

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043950	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0076925_10118292	F043950	N/A	MSQVTHNIYTINASYDTKYCSFGRFFGKKNGILPCKQDAKLNMVIKILI*