Basic Information | |
---|---|
Taxon OID | 3300005735 Open in IMG/M |
Scaffold ID | Ga0076923_111717 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2077 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 41.4417 | Long. (o) | -70.7744 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014926 | Metagenome / Metatranscriptome | 259 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0076923_1117173 | F014926 | N/A | VFKRLQQVWKYSDSQPTEITLGAALMILAPIATCMELGFMPFFQLVLVTAGGYQIYCVSKGDLACRIRAAFFTFGLYASSLVMFLMSIGLPSPSHYGWVVLVISSFGNLRRLKTEQLHRNG* |
⦗Top⦘ |