NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0076919_1031417

Scaffold Ga0076919_1031417


Overview

Basic Information
Taxon OID3300005731 Open in IMG/M
Scaffold IDGa0076919_1031417 Open in IMG/M
Source Dataset NameSeawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1958
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → M → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.4417Long. (o)-70.7744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005937Metagenome / Metatranscriptome386Y
F010314Metagenome / Metatranscriptome305Y

Sequences

Protein IDFamilyRBSSequence
Ga0076919_10314173F005937N/AMSSKIDINGDGKADFSISITQIITIAAMFASIIGSYYTLSNRITIAEEEVSKLKYNQKEYTWKNQRALEDEVKAMKLEMRDFMKDLEWIQKDKRR*
Ga0076919_10314174F010314N/AMENLKIYGFNAIALALSITEINPYLQTISLLLAIGYTIISISKKLK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.