Scaffold Ga0076919_1022358

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0076919_1022358

Scaffold Ga0076919_1022358

Overview

Basic Information
Taxon OID	3300005731 Open in IMG/M
Scaffold ID	Ga0076919_1022358 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1030
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → M → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location Name	USA
Coordinates	Lat. (^o)	41.4417	Long. (^o)	-70.7744	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007835	Metagenome / Metatranscriptome	344	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0076919_10223582	F007835	AGCAG	MPFGPTTLRNKREEFVLQKIEYYKVNEYMGRSNWKRHYFDTYKEAVKMFKKLKEEKRKILIYACRNDELGEISTGLNDRFINE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.