Scaffold Ga0074432_108859

Overview

Basic Information

• Taxon OID: 3300005683
• Scaffold ID: Ga0074432_108859
• Source Dataset Name: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91802 Phage Sequencing
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1520
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Source Dataset Sampling Location

• Location Name: St. Lucia, Queensland Australia
• Coordinates
  • Lat. (^o): -27.49999
  • Long. (^o): 153.012098

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011936	Metagenome / Metatranscriptome	285	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074432_1088593	F011936	AGG	LNEQLHETRLQKLEQGHDMLSRDYSRLNDAIVKISESLMALVVIQEQNKAIMSCIERQQSSIDKLDGRLDALEVQQPQLLELRSWVLGGFGTI