Scaffold Ga0073685_1000285

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073685_1000285

Scaffold Ga0073685_1000285

Overview

Basic Information
Taxon OID	3300005664 Open in IMG/M
Scaffold ID	Ga0073685_1000285 Open in IMG/M
Source Dataset Name	Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	16941
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic → Freshwater Viral Communities From Emiquon Reservoir, Havana, Illinois, Usa

Source Dataset Sampling Location
Location Name	Havana, Illinois, USA
Coordinates	Lat. (^o)	40.362238	Long. (^o)	-90.047137	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091908	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073685_10002857	F091908	N/A	MAGQMKTANKCPEVVTSPTRYTGGKNANVTVVTNPTRYNGGLNKAACDVPNGKLKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.