Scaffold Ga0078894_10097550

Overview

Basic Information

• Taxon OID: 3300005662
• Scaffold ID: Ga0078894_10097550
• Source Dataset Name: Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2590
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103250	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0078894_100975505	F103250	AGGA	MEKIEINTKYGWASARIGRYSNGHLGIQLFQDGSPLARISANLIDTVLEPREFHFNSNDAGSMKEDVLKSGHFEDTGKTNFSGFCEYPVFKLKDHVEVVEG*