Scaffold Ga0077110_1027965

Overview

Basic Information

• Taxon OID: 3300005639
• Scaffold ID: Ga0077110_1027965
• Source Dataset Name: Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Combined assembly reannotation Gp0050987, Gp0050988, Gp0050989, Gp0050990, Gp0050991
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 759
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle, USA
• Coordinates
  • Lat. (^o): 47.676484
  • Long. (^o): -122.228394
  • Depth (m): 63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017845	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077110_10279652	F017845	AGGAGG	MDTALALAGPYAAPALGFTGEPAQQEDVIWWIVVVGFAYAVALAWATWCRHNGGSAEISFGWTGFKVACRSR*