Scaffold Ga0070763_10267264

Overview

Basic Information

• Taxon OID: 3300005610
• Scaffold ID: Ga0070763_10267264
• Source Dataset Name: Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 931
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location

• Location Name: USA: New Hampshire, Hubbard Brook experimental Forest
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024836	Metagenome / Metatranscriptome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070763_102672641	F024836	AGGA	MTGGRPAERRPMRRRSRLRWMVTGGVAACWLVLAVATGSVVSATVVLMVVAALAAAGVGGLRALGITRDHPWLRRLASRPWRDGQDVLQVVMRHLADVFVITPSGALIAPNLVELQLNPDDLDFLCERMEPGVISASMTEVYEEQVTAYGARLAGAGRAQVYVIAAGSVPPGRYRLRQGDPVSIDAQPDGYANAAPEWAYSAPQHGYAESGSQPDPDLTVGGGMVTIMEPSPTLIPVLQLVTGSSVAETRVSGARAGRGSVELVLPDVLTVSREHATFTFSDGR