Scaffold Ga0070722_10235035

Overview

Basic Information

• Taxon OID: 3300005601
• Scaffold ID: Ga0070722_10235035
• Source Dataset Name: Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 766
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location

• Location Name: Atlantic Coast
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105207	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070722_102350352	F105207	GAG	MLLGKGHKFLEKGRYQEALEKALKAKSLKLEEQFEWLCHSIEGKSRYHLGDKENALPSLRRAQEILASKLEKEKESKPLQNIMDDITGYIEKIEHGDA*