Scaffold Ga0070761_10117223

Overview

Basic Information

• Taxon OID: 3300005591
• Scaffold ID: Ga0070761_10117223
• Source Dataset Name: Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1544
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location

• Location Name: USA: New Hampshire, Hubbard Brook experimental Forest
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070817	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070761_101172234	F070817	GAGG	MMAWIGRRLRLAVRTVIRAVRIANDEQVYMWECLLLTSRAVPTSATGPLRWVPSLDGNRLVGSYLPT*