Basic Information | |
---|---|
Taxon OID | 3300005573 Open in IMG/M |
Scaffold ID | Ga0078972_1017309 Open in IMG/M |
Source Dataset Name | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 10382 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (92.31%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.611006 | Long. (o) | -110.440182 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081385 | Metagenome / Metatranscriptome | 114 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078972_10173097 | F081385 | GGAGG | VETVIKTAIALVTTAILTGTWAIARKRYRLLNQRDELLAEVQKTLMAVRDDNRCQYTALLAVIDAQELQLHALKGKKMNGNVDDALAKIGKAREEIQAHLVEVGCK* |
⦗Top⦘ |