NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074648_1072373

Scaffold Ga0074648_1072373


Overview

Basic Information
Taxon OID3300005512 Open in IMG/M
Scaffold IDGa0074648_1072373 Open in IMG/M
Source Dataset NameSaline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1343
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location NameGreece: Etoliko Lagoon
CoordinatesLat. (o)38.4825Long. (o)21.315Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001139Metagenome / Metatranscriptome767Y
F002768Metagenome / Metatranscriptome531Y
F012735Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0074648_10723731F012735AGGAGMSKKRQATSSKLETTIRILHEEWALDQGLRSKRQATSIKRQAASLKHVPRYVSSDYKATSVKRQALTEIP
Ga0074648_10723733F001139AGGAGGMRIKNNDLTHWFIRDHDQLPEAYLRSCKKFFKELSDKQQASSVKHQARQTGQLWKPGIRVKNRFNRKV*
Ga0074648_10723734F002768AGGAGGMNRKKSWWSLKIEGYPEYEPNDADLEHIAECIKQGYDNGELIQEAEDADQE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.