Scaffold Ga0074259_11945860

Overview

Basic Information

• Taxon OID: 3300005507
• Scaffold ID: Ga0074259_11945860
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: University of North Carolina
• Coordinates
  • Lat. (^o): 35.9
  • Long. (^o): -79.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044106	Metagenome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074259_119458601	F044106	N/A	NDRFTAEVEIAKADFADLGITRGNGFRDEVVQLRVLRGGAQIFANRLQFSRNLVHDITFETDIRGTPAPELHAGDVVRVSVNGHFTLRGQLQVH*