Scaffold Ga0068898_10116717

Overview

Basic Information

• Taxon OID: 3300005505
• Scaffold ID: Ga0068898_10116717
• Source Dataset Name: Soil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 5A (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1146
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: Colorado Plateau and Sonoran desert
• Coordinates
  • Lat. (^o): 38.42
  • Long. (^o): -109.4099

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056792	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068898_101167171	F056792	N/A	RGAPMVTLEMVPLRSKMPHTGRVTLRYALPTVKIDFPVDTRAGLPRIATTPQVEQPQEGAELETTARKGGEAR*