Scaffold Ga0074212_123257

Overview

Basic Information

• Taxon OID: 3300005491
• Scaffold ID: Ga0074212_123257
• Source Dataset Name: Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Formaldehyde enrichment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 887
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle, Washington, USA
• Coordinates
  • Lat. (^o): 47.63458
  • Long. (^o): -122.26655
  • Depth (m): 63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072884	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074212_1232572	F072884	AGGGGG	VRLYVVQMFYSSLKESAPLVAEAKNNVAALSKKDFVLMGFGEHTAAIAFASTEPEANMRAQFERIRGENFSLIAFEAAWIVGGNMSKDVSLWLERHQPSPFK*