NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070662_100450626

Scaffold Ga0070662_100450626


Overview

Basic Information
Taxon OID3300005457 Open in IMG/M
Scaffold IDGa0070662_100450626 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1068
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015906Metagenome / Metatranscriptome251Y
F018405Metagenome / Metatranscriptome235Y
F021660Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0070662_1004506261F018405N/ARAFMNTSDIYRQAIKRTFAGLYGVAPDKVDVSWSDTGDNITVRCADKTFTHETLHDDDEPTLEFVGDGAVTVRLTTAELLRLEGIDGFNGF*
Ga0070662_1004506262F015906N/AMSTGKVYKQAIKRVFAEKYHDERMAVYWGREDDTIHVVASLRHYVHKIAGANEDTLEFVSSVGDCVTVKLTDDERRELIAQSSAIH*
Ga0070662_1004506263F021660N/ALLEADARGSFTFTFSSARGEMSGRVNVGTEGPPDRRSVSDKEQAAKNQILALARELALSIWPE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.