NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070708_100008193

Scaffold Ga0070708_100008193


Overview

Basic Information
Taxon OID3300005445 Open in IMG/M
Scaffold IDGa0070708_100008193 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8385
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (73.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001851Metagenome / Metatranscriptome626Y
F003202Metagenome / Metatranscriptome501Y
F003634Metagenome / Metatranscriptome476Y
F031999Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0070708_10000819310F031999AGGAMKNIKFVVNVNRGGSRAPKYVQRVDPTPIQMTTNPKLSLLMGRFTAVYPGVGIRKG*
Ga0070708_10000819311F001851AGGMNATSIFFGLLIVLFMILHWMRKAKPQIAGGQSQRMCPNCGLITPRLKASCLECGKPFTAVVYSASKK*
Ga0070708_10000819314F003634N/AMNFLTSISSSMPLHWWVALIISALGIAAICLRAFETEDSRTRRAERNKKKELRSLAEKISSYGHTVHQRNPTGDVIVSELDLAEQLRKRPDAVATALNLLLNEQKVQRATLSGYWKLNV*
Ga0070708_1000081938F003202GGAGGMTLRNLAMALLITLVLAAGVGLHNYESARNAAVVRQLSDQLEQTKSELVDATTQLSEANKKLGFLESSKARVQVTAYALTDDFGPDPVFSTNAPARSAYAVPKHTLPAEKVLNVALSPMAERKLHASLNDTIVLMSGDRARNHLARFVDRTVQTETRSVVDILFADAHEARIWGRRSFYAVNISRPDSPFQQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.