Scaffold Ga0066828_10023944

Overview

Basic Information

• Taxon OID: 3300005423
• Scaffold ID: Ga0066828_10023944
• Source Dataset Name: Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2293
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Eastern Tropical North Pacific
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078818	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066828_100239446	F078818	AGG	MTIKKNKKLTKEQLEEIQRYMDKVLEENQVLGERCKDFLNSVRTHLFDEINVSELPRELLIYLLQRELLILSKNLLPEKRLDHALIIIHEAIADTLKDSLYPEPAEKVSVH*