Scaffold Ga0068882_1291286

Overview

Basic Information

• Taxon OID: 3300005421
• Scaffold ID: Ga0068882_1291286
• Source Dataset Name: Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 631
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Brachyspirales → Brachyspiraceae → Brachyspira → Brachyspira hampsonii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location

• Location Name: USA: Ohio, Lake Erie
• Coordinates
  • Lat. (^o): 41.69957
  • Long. (^o): -83.2941

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056287	Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068882_12912861	F056287	N/A	HAVGTPMGVGNLVWAKECIKKGVDVNVRLDVYGGTALFLAIEQCNWAMVTWLVEDAKLDLELVDYGGYNALDYAACHCHHPDKPPLLPDGTTAPMDIASYLKSQGMQYTWFGAAMAEDIDRLWEFLENGQDVNERGGHFNRTAVEEAVDNGGFWTARFLMVKGGIAGSIPSHISMPEESECLGFIQGKLAK*