Scaffold Ga0074246_141

Overview

Basic Information

• Taxon OID: 3300005372
• Scaffold ID: Ga0074246_141
• Source Dataset Name: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter Sample 10334
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 44278
• Total Scaffold Genes: 54
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 26 (48.15%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location

• Location Name: Late winter and summer Antarctic waters
• Coordinates
  • Lat. (^o): -64.067
  • Long. (^o): -64.767

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013024	Metagenome / Metatranscriptome	275	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074246_14133	F013024	N/A	MYEIKKDKLSKDFLTKKLFWLGIIGTYIIAGVMLNKLENNADYDDLILISIIPSSYYFFMLFLSYKSFKDEAIRTTILQFTIQILLLLPLMSMYMAVLLFSTKIS*