Scaffold Ga0008090_15851223

Overview

Basic Information

• Taxon OID: 3300005363
• Scaffold ID: Ga0008090_15851223
• Source Dataset Name: Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 933
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales

Source Dataset Sampling Location

• Location Name: Amazon Forest, Brazil
• Coordinates
  • Lat. (^o): -10.0
  • Long. (^o): -62.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007784	Metagenome / Metatranscriptome	345	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0008090_158512231	F007784	AGGAG	MKKLLISVAMLAMAGSAANTQENDPPPRFQPWQQVWQCNDIRVTITGRDPYSVEYDLGGTIWGGAHFTVVKGQLFFNERPCLPLRPAGY*