Basic Information | |
---|---|
Taxon OID | 3300005363 Open in IMG/M |
Scaffold ID | Ga0008090_15204165 Open in IMG/M |
Source Dataset Name | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 619 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon Forest, Brazil | |||||||
Coordinates | Lat. (o) | -10.0 | Long. (o) | -62.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061994 | Metagenome / Metatranscriptome | 131 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0008090_152041651 | F061994 | GGTGG | MLWLLTIVTTGVLLLIAGFVKEISKVPTVARPAALTKTAHAARHAAVSPASRRGSSPTASAKVPETTDASSGLSYRLL |
⦗Top⦘ |