Scaffold Ga0070674_100079615

Overview

Basic Information

• Taxon OID: 3300005356
• Scaffold ID: Ga0070674_100079615
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2338
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan, Kellogg Biological Station
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063115	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070674_1000796154	F063115	GAG	MTLRKRSKPYSNIENGLLKGTSSTNQATVPKGRRLIIEYVSGFIFRPPSSALTAETTMAVTDPTLGLNGAGFHIFPAVKVNSTPQNDVFAFSAPLKMMLDPGASFYFSGVAGLAVSGYLVKFRGA*