Scaffold Ga0074242_11902324

Overview

Basic Information

• Taxon OID: 3300005346
• Scaffold ID: Ga0074242_11902324
• Source Dataset Name: Saline sediment microbial community from Etoliko Lagoon, Greece
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1268
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Etoliko Lagoon, Greece
• Coordinates
  • Lat. (^o): 38.482158
  • Long. (^o): 21.313175

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018704	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074242_119023241	F018704	N/A	MSSSNISSVTKTADAAAISGRTRVVGIYYTCTNTGSSFSLKNGSTSGGTALVSITTPGAAGGYDIIIPDMGILFDSGVFVDVGDVEVTSVTLFFQGGAAA*