NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070680_100029821

Scaffold Ga0070680_100029821


Overview

Basic Information
Taxon OID3300005336 Open in IMG/M
Scaffold IDGa0070680_100029821 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4379
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044761Metagenome154N
F049057Metagenome147N

Sequences

Protein IDFamilyRBSSequence
Ga0070680_1000298212F044761AGGGGGVRILLAAGVVLTIATTIGNADAGYLIQLRNGNDYVTARYWREGNQILFDTYGGVFGVEKNFIAQIIKTDDVAGLNSASYREPATNLLNRGLNDKKELRDNGSDPPLSRTKADDNDPIRGEFNRLKEKVSEVDGMLTAEIRELLNQITAFKNKLSRDSKLFIQYGREFNDAHELGSAVETALVSRTQ*
Ga0070680_1000298216F049057GGAGMLQNDYRILGNLRSSTHSFYYSVAGIEWSKNQIAELDIFPPTPANQTQSFANGAFDVRFSVPAVTGPLTARLTVRSTGTVDNATHVIEAQLTKAYELSDAALTVRGNPARAVLSGGEILISGTDHDQTNGTPRSGAKPRLAISASSETVRGLLSQSIENPEILDGASLAPLVAQSDYLPANFINQLAGDLCSVPTALLHPISTIGSLTIANQIWGSQSSPEIHCVDGLSVSGDSITITGNVSGAGILVVSNADLVLSGSFHWQGLVIVNGQEVGLRTVGSSIKEIVGAVVLNETGAPSSTTAIMEIQGNLRLLFSREALKTAAELIPAATLTSAYGNLPFLVTQNYWRNVAQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.