Scaffold Ga0065707_11174461

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065707_11174461

Scaffold Ga0065707_11174461

Overview

Basic Information
Taxon OID	3300005295 Open in IMG/M
Scaffold ID	Ga0065707_11174461 Open in IMG/M
Source Dataset Name	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	500
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location Name	East Lansing, MI
Coordinates	Lat. (^o)	42.794771	Long. (^o)	-84.393804	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029598	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065707_111744612	F029598	N/A	DVESVATGNRVTLLVLGTGNKWATRTEPDLYMLVAARNPTPTEKVQLDLSECQAAARTVWNSDAAARDRTFLAAQGPAYNPGAEVSKATMDLLAKTYENCLQPKGYTASPPVPK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.