Scaffold Ga0065715_11038423

Overview

Basic Information

• Taxon OID: 3300005293
• Scaffold ID: Ga0065715_11038423
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan State University
• Coordinates
  • Lat. (^o): 42.406189
  • Long. (^o): -85.40016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026444	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065715_110384232	F026444	N/A	QSVLEKNDMRSSYLVEGTLMAKYVKSNNVKLQDPRELNEVFQKQDTSLEEELTRILLK*