Scaffold Ga0065712_10114474

Overview

Basic Information

• Taxon OID: 3300005290
• Scaffold ID: Ga0065712_10114474
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1766
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan State University
• Coordinates
  • Lat. (^o): 42.406189
  • Long. (^o): -85.40016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012488	Metagenome / Metatranscriptome	280	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065712_101144741	F012488	GAGG	VNLLGISRLRLLTGLIVLFAFGGDIVADSIVDSLGEHCAAQTCPSDSHHDKTPCSHCSCAVHNGSVIAANNGVHVSADVQPSVFILIGDELAQVGPPAAIDHPPQLA*