Scaffold Ga0065720_1045441

Overview

Basic Information

• Taxon OID: 3300005281
• Scaffold ID: Ga0065720_1045441
• Source Dataset Name: Thermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1807
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley

Source Dataset Sampling Location

• Location Name: Davis, California, USA
• Coordinates
  • Lat. (^o): 38.5402727
  • Long. (^o): -121.7500776

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076964	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065720_10454413	F076964	GGAG	MSDSKVWLRPPWGEGEPKEVEATPAVLVPLLVAGWSQCAPPEPEVKEDVHD*