Scaffold Ga0065696_1330524

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065696_1330524

Scaffold Ga0065696_1330524

Overview

Basic Information
Taxon OID	3300005280 Open in IMG/M
Scaffold ID	Ga0065696_1330524 Open in IMG/M
Source Dataset Name	Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	519
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil → Switchgrass Rhizosphere Bulk Soil Microbial Community From Michigan, Us

Source Dataset Sampling Location
Location Name	East Lansing, MI
Coordinates	Lat. (^o)	42.704677	Long. (^o)	-84.468818	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043556	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065696_13305241	F043556	N/A	VAAKREQLAGEAARERFHARLEAFAEPVSFSNVVLLAATLHLVFRRQRRRFLEHAAFSMHAVNFVLLSSLTLFVAIRLRFWLGSYLLLTFALLFLWQFAYLTVAIRRFYLAKGRWGGWLLSVAAALLLYVLNSAF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.