Scaffold Ga0065696_1297410

Overview

Basic Information

• Taxon OID: 3300005280
• Scaffold ID: Ga0065696_1297410
• Source Dataset Name: Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 510
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil → Switchgrass Rhizosphere Bulk Soil Microbial Community From Michigan, Us

Source Dataset Sampling Location

• Location Name: East Lansing, MI
• Coordinates
  • Lat. (^o): 42.704677
  • Long. (^o): -84.468818

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061035	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065696_12974101	F061035	N/A	AAFKEGGAAGLRKALGGAALGSIRLGSGQPTPARIAIERTTDKGRLLTLVTDKPILFLGAGVPGAKPKEGYDFAVVDIEVDASGSGSGSLAPAAKITLKQGAFVVDDYAQELVRLTGVKKVK*