NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065702_101153

Scaffold Ga0065702_101153


Overview

Basic Information
Taxon OID3300005266 Open in IMG/M
Scaffold IDGa0065702_101153 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameCentral Sands area of central Wisconsin.
CoordinatesLat. (o)44.166906Long. (o)-89.649965Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004481Metagenome / Metatranscriptome436Y

Sequences

Protein IDFamilyRBSSequence
Ga0065702_1011531F004481N/AMFVIAAFLLFANAPFAFAKPQKKPAAPAQENADPLVNAAMKNMETGVWSVNGTVTAKKPIKLQGLLSGEDFDLTMEPGVNPNTPMREIVIKNKAWICSDGETWHAGQPNDRLIYNWAHVPIMADRKLPPFEKVGSEQRNGQTLLHVRLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.