NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065702_101046

Scaffold Ga0065702_101046


Overview

Basic Information
Taxon OID3300005266 Open in IMG/M
Scaffold IDGa0065702_101046 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)516
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameCentral Sands area of central Wisconsin.
CoordinatesLat. (o)44.166906Long. (o)-89.649965Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068675Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0065702_1010462F068675N/AMTIRTSLRDYACTALALLTVLSSRSIALSQQEKEIDIWNAAPSDLTFAVTQVPPVATVTQVAPEDSALTSTEQGHTTLEESFDYREWRLE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.