Scaffold Ga0071345_1013351

Overview

Basic Information

• Taxon OID: 3300005261
• Scaffold ID: Ga0071345_1013351
• Source Dataset Name: Freshwater pond sediment microbial communities from Midddleton WI, HA 3/4 enriched by Glucose under anaerobic conditions -HA Sample 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11564
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humic Acid And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates
  • Lat. (^o): 43.0603
  • Long. (^o): -89.5717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085790	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071345_101335110	F085790	GAG	MKQNHDFPPAPNPPLKSDPACIAFLSLSTSRYLGSARRLGAGVAA*