Scaffold Ga0074072_1060793

Overview

Basic Information

• Taxon OID: 3300005260
• Scaffold ID: Ga0074072_1060793
• Source Dataset Name: Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Centre for Ecogenomics
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1070
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar

Source Dataset Sampling Location

• Location Name: Sydney
• Coordinates
  • Lat. (^o): -33.917926
  • Long. (^o): 151.235347

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039184	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074072_10607932	F039184	AGGA	VDADWGFLRACDLARTADENFKLAWIDTIEAAWQVTDLDHGDFGFIVLMADGRRVYWRYTSEDTGAGRPEDLVVTELGTGEVPEGDAPWSRPETLNKRLAVLRRLT*