Scaffold Ga0071344_1038503

Overview

Basic Information

• Taxon OID: 3300005259
• Scaffold ID: Ga0071344_1038503
• Source Dataset Name: Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid and Glucose under anaerobic conditions - HA Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3075
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humic Acid And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates
  • Lat. (^o): 43.0603
  • Long. (^o): -89.5717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089856	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071344_10385033	F089856	AGGA	MNALRFLVLALAASALAGCTTFANRPTGLTPIPCTYRFKALSRAEDQSRVEAAIHTVAIGPVVKAGTLAYPEYRFRVARLADLDRLAPQLLYSNPNTLIATTRKQTLNLNACSVDMTFDSTDVSASATTLVTFNVKPGSRLYYKTPGGVETDITAKIGKKGKVVLPIAVKEGQKYLYVRAMKDXFIRINIFTNQTEDISRREY*