Scaffold Ga0071344_1024760

Overview

Basic Information

• Taxon OID: 3300005259
• Scaffold ID: Ga0071344_1024760
• Source Dataset Name: Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid and Glucose under anaerobic conditions - HA Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5188
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix harundinacea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humic Acid And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates
  • Lat. (^o): 43.0603
  • Long. (^o): -89.5717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091072	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071344_10247607	F091072	N/A	MAGTVKETIAPICEETKEDIKALLKGTDVAWAQYKRCHGTKVTDTKELDEFLDSL*