Scaffold Ga0068714_10065937

Overview

Basic Information

• Taxon OID: 3300005254
• Scaffold ID: Ga0068714_10065937
• Source Dataset Name: Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1944
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading

Source Dataset Sampling Location

• Location Name: USA: New York Harbor
• Coordinates
  • Lat. (^o): 40.67
  • Long. (^o): -74.01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061951	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068714_100659373	F061951	AGTAGG	MMDWKWTQTRQRIARQLGKGAITLAVIVAAQVVALEVVLRGWQNEDAGAVFAGISASALLCALAVIIFLRTKQKVPQ*