Scaffold Ga0073583_1142539

Overview

Basic Information

• Taxon OID: 3300005253
• Scaffold ID: Ga0073583_1142539
• Source Dataset Name: Marine sediment microbial community near Loki's castle
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Uppsala University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3653
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Community From Loki's Castle, Arctic Ocean

Source Dataset Sampling Location

• Location Name: Loki's castle hydrothermal vent
• Coordinates
  • Lat. (^o): 73.763167
  • Long. (^o): 8.464
  • Depth (m): .74

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034408	Metagenome / Metatranscriptome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073583_11425393	F034408	AGGAG	MLPRDQDVRNLAIYAPRLAYAMIIGVPRVPFIADIPIQFSSSTVNAPSIDQSFNNNLTQDTMIERVSFNVFQQNSFPGSPFQSLYFNQLKQSGQIGVGIQMQVFGGPKYAINDLFTDLGTLADVFAMTWPQGWPLAKQSNVRVIATLTQTPVSVPYNILISFLGWQLLDKSVEDLSDAEARSRLRKLGFESPDLASLLKP*