Scaffold Ga0073579_1169159

Overview

Basic Information

• Taxon OID: 3300005239
• Scaffold ID: Ga0073579_1169159
• Source Dataset Name: Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 54077
• Total Scaffold Genes: 64
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 23 (35.94%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Environmental Genome Shotgun Sequencing: Ocean Microbial Populations From The Gulf Of Maine

Source Dataset Sampling Location

• Location Name: Gulf of Maine, USA
• Coordinates
  • Lat. (^o): 43.2393
  • Long. (^o): -68.368612

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013024	Metagenome / Metatranscriptome	275	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073579_116915958	F013024	AGAAG	MKVENIEKPTTKFIATKLFWVGVVGTYILAGMLLNRLETNASYEELRSSSLIPSIFYFFILFLSYRSFETQAVRTTILQFVTQMLLLLPLMSMYLAVVLFTTKFSS*