Scaffold Ga0066637_10299749

Overview

Basic Information

• Taxon OID: 3300005235
• Scaffold ID: Ga0066637_10299749
• Source Dataset Name: Groundwater microbial communities from aquifer - Crystal Geyser CG08_land_8/20/14_0.20
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 618
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Moranbacteria → Candidatus Moranbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_39_10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location

• Location Name: USA: Utah: Grand County
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002184	Metagenome	585	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066637_102997491	F002184	N/A	MKYIAKYSRVCWDEDVKPIQKQCQQTLYTNELCSIPNKDNYANF