Scaffold Ga0069005_10088180

Overview

Basic Information

• Taxon OID: 3300005217
• Scaffold ID: Ga0069005_10088180
• Source Dataset Name: Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 750
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location

• Location Name: USA: Alameda, San Francisco Bay, California
• Coordinates
  • Lat. (^o): 38.107536
  • Long. (^o): -121.649704

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067892	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069005_100881801	F067892	AGGAG	MPEEKAQFQIDKTNLIKAGRIPVIAAAIGGALWLLGFLGGLMGILFWVVAAFAGYWYVNLVLKSGAKPTILEVAMNGTILGAVVGLVYAVVTWIAISIRYPGFVGLAYRWGVGSLIRTLLEGGIGGAIGAAGWYAYKS