Scaffold Ga0072940_1067546

Overview

Basic Information

• Taxon OID: 3300005200
• Scaffold ID: Ga0072940_1067546
• Source Dataset Name: Nasutitermes gut metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3141
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location

• Location Name: Murphy's Creek, Queensland, Australia
• Coordinates
  • Lat. (^o): -27.45
  • Long. (^o): 152.04

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000731	Metagenome	916	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072940_10675462	F000731	AGGA	MVVISLLTGRNILRRHLHIMGLCNDPICRKCGTEEETSVHILCKCEALASLRHAHLGSFFLDPEDIRVLGMGTIWNFAKGIGLL*