Scaffold Ga0073162_1024612

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073162_1024612

Scaffold Ga0073162_1024612

Overview

Basic Information
Taxon OID	3300005196 Open in IMG/M
Scaffold ID	Ga0073162_1024612 Open in IMG/M
Source Dataset Name	E2 T6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	586
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Mallorca 2014 E2

Source Dataset Sampling Location
Location Name	Salinas de Campos (Mallorca)
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049200	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073162_10246122	F049200	N/A	MDDLELGQRLALPYRSDDTSISVPAEITGIGLPAVRVETDSGETYIRHARNVREWTRHLR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.