Basic Information | |
---|---|
Taxon OID | 3300005193 Open in IMG/M |
Scaffold ID | Ga0073160_1007980 Open in IMG/M |
Source Dataset Name | E5 T11 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Alicante |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 948 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → environmental Halophage eHP-30 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Mallorca 2014 E5 |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Salinas de Campos (Mallorca) | |||||||
Coordinates | Lat. (o) | 39.338015 | Long. (o) | 3.051796 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062484 | Metagenome | 130 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073160_10079802 | F062484 | N/A | MYLIGSKIKVQAYIAKVDKHEGFTGNLTKSWAEPRKHPDKDLYAVPKNESVQPDTQLTEKEQLPEGWQPDDPLA* |
⦗Top⦘ |