Scaffold Ga0073158_1006106

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073158_1006106

Scaffold Ga0073158_1006106

Overview

Basic Information
Taxon OID	3300005191 Open in IMG/M
Scaffold ID	Ga0073158_1006106 Open in IMG/M
Source Dataset Name	E5 T8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	877
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → environmental Halophage eHP-30	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Mallorca 2014 E5

Source Dataset Sampling Location
Location Name	Salinas de Campos (Mallorca)
Coordinates	Lat. (^o)	39.338015	Long. (^o)	3.051796	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062484	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073158_10061062	F062484	N/A	MWLIGSKENIKSYIAKVDQHEGFTGNLTKSWAEPRKHPTKDLYAVPKNNSVQPDSQLTEKEELPSDWYPDDPLA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.