Scaffold Ga0068993_10170912

Overview

Basic Information

• Taxon OID: 3300005183
• Scaffold ID: Ga0068993_10170912
• Source Dataset Name: Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 743
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location

• Location Name: USA: San Francisco Bay, California
• Coordinates
  • Lat. (^o): 38.045666
  • Long. (^o): -121.866516

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059091	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068993_101709123	F059091	GGA	MPTSSAKPRLVPCHFTVDDLQLIEWSCREKAQRARNDAKRDTTPSSIETFTSTAAKYEALAIRIQRLKELGVR*