Scaffold Ga0066869_10068935

Overview

Basic Information

• Taxon OID: 3300005165
• Scaffold ID: Ga0066869_10068935
• Source Dataset Name: Soil and rhizosphere microbial communities from Laval, Canada - mgHMC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 658
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas → Stenotrophomonas maltophilia group → Stenotrophomonas maltophilia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location

• Location Name: Laval, Canada
• Coordinates
  • Lat. (^o): 45.54
  • Long. (^o): -73.72

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034485	Metagenome / Metatranscriptome	174	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066869_100689351	F034485	GGA	MHPTRLLQLCALPMALGLLLAPARAQAPEHSKDEAPLELPADEPLDLSTPEPDAGTLKVTTPLADKPSAPEWISKAGIDYSKPAIPAVTFQPDQL